Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry

Pendentifs en pierre dansante à motif de chat - CD13

People are viewing this right now
sold in last hours
$648.00 HKD
In Stock Pré-commande Out of stock

Métal: Argent S925 (plaqué platine)

Argent S925 (plaqué platine)
Or blanc 9K
Or jaune 9K
Or rose 9K
Or blanc 18K
Or jaune 18K
Or rose 18K
PT950 Platine
Add to WishlistCompare
Code produit CD13
Pierre principale RZ®Simulation de diamant
Forme Taille ronde brillante
Couleur de la pierre principale Transparent(D)
Pierre principale Poids de la pierre (ct) 0.50
Clarté Sans défaut(FL)
Taille Excellente
Largeur(mm) 9.5
Length(mm) 9.6

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club